- GLIPR1L1 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-82722
- This antibody was developed against Recombinant Protein corresponding to amino acids: SKIPSITDPH FIDNCIEAHN EWRGKVNPPA ADMKYMIWDK GLAKMAKAWA NQCKFEHNDC LDKSYKCYAA FEYVGENIWL GGIKS
- 0.1 ml (also 25ul)
- PBS (pH 7.2) and 40% Glycerol
- Rabbit
- ALKN2972, PRO7434
- GLIPR1L1
- Unconjugated
- Immunohistochemistry, Immunohistochemistry-Paraffin
- Human
- GLIPR1 like 1
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
SKIPSITDPHFIDNCIEAHNEWRGKVNPPAADMKYMIWDKGLAKMAKAWANQCKFEHNDCLDKSYKCYAAFEYVGENIWLGGIKS
Specifications/Features
Available conjugates: Unconjugated